Denileukin Diftitox

Denileukin Diftitox

Masse/Länge Primärstruktur 57,6473 kDa
Bezeichner
Externe IDs CAS-Nummer: 173146-27-5
Arzneistoffangaben
ATC-Code L01XX29
DrugBank DB00004
Wirkstoffklasse Immuntoxin
Verschreibungspflicht ja

Denileukin Diftitox, auch als DAB(389)IL-2 bezeichnet, ist der internationale Freiname für ein in den Vereinigten Staaten zugelassenes Immuntoxin zur Behandlung von Patienten mit therapierefraktären kutanem T-Zell-Lymphom.

Beschreibung

Denileukin Diftitox ist ein rekombinant, das heißt gentechnisch, in Kulturen von Escherichia coli hergestelltes, zytotoxisches chimäres Fusionsprotein. Es besteht aus einer Interleukin-2-Peptid-Sequenz, die mit der des Diphtherietoxins fusioniert wurde. Das Interleukin-2 bindet dabei an den Interleukin-2-Rezeptor, der im Wesentlichen von T-Lymphozyten exprimiert wird – so auch von den malignen T-Lymphozyten.[1][2] Nach der Bindung an den Rezeptor wird das Immuntoxin von der Zelle per rezeptorvermittelter Endozytose internalisert. Im Endosom wird das Immuntoxin proteolytisch gespalten und dabei das katalytisch aktive A-Fragment des Toxins freigesetzt.[1] Die enzymatische Domäne des Toxins (das A-Fragment) katalysiert die Modifikation von Diphthamid, einer aus Histidin gebildeten Aminosäure, durch Übertragung eines ADP-Ribose-Restes aus NAD+ unter Abspaltung von Nicotinamid auf das Diphtamid (ADP-Ribosylierung). Der Elongationsfaktor-2 (EF-2), ein Enzym das die Translation bei der Proteinsynthese katalysiert, enthält Diphthamid. Durch die Modifikation des Diphthamids wird EF-2 in seiner Translationsfähigkeit gehemmt und die Proteinsynthese in der Zelle unterbrochen, was letztlich zum Tod der Zelle führt.[3]

Denileukin Diftitox wurde 1999 in den Vereinigten Staaten als erstes Immuntoxin von der FDA zugelassen. In Europa ist dagegen nicht zugelassen. Verschiedene klinische Studien für andere Indikationen, beispielsweise gegen Mycosis fungoides und malignes Melanom, sind derzeit am Laufen.

Denileukin Diftitox wird intravenös appliziert. Die Nebenwirkungen sind teilweise erheblich. Übelkeit, Erbrechen, Durchfall, Erschöpfungszustände, Atemschwierigkeiten, Fieber, Husten, Juckreiz und periphere Ödeme werden in über 20 Prozent der Patienten beobachtet. Bei über 10 Prozent ist das Vascular-Leak-Syndrom zu beobachten.[4] Es gibt Hinweise darauf, dass die Gabe von Denileukin Diftitox zu einem Verlust der Sehkraft führen kann.[5]

Denileukin Diftitox hat die folgende Proteinsequenz (im Einbuchstabencode):

MGADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDDWKGFYSTDNK
YDAAGYSVDNENPLSGKAGGVVKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLMEQVG
TEEFIKRFGDGASRVVLSLPFAEGSSSVEYINNWEQAKALSVELEINFETRGKRGQDAMY
EYMAQACAGNRVRRSVGSSLSCINLDWDVIRDKTKTKIESLKEHGPIKNKMSESPNKTVS
EEKAKQYLEEFHQTALEHPELSELKTVTGTNPVFAGANYAAWAVNVAQVIDSETADNLEK
TTAALSILPGIGSVMGIADGAVHHNTEEIVAQSIALSSLMVAQAIPLVGELVDIGFAAYN
FVESIINLFQVVHNSYNRPAYSPGHKTHAPTSSSTKKTQLQLEHLLLDLQMILNGINNYK
NPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVI
VLELKGSETTFMCEYADETATIVEFLNRWITFCQSIISTLT

Handelsname

Denileukin Diftitox wird in den USA unterm dem Markennamen Ontak vertrieben.

Literatur

  • J. W. Eklund und T. M. Kuzel: Denileukin diftitox: a concise clinical review. In: Expert Rev Anticancer Ther 5, 2005, S. 33–38. PMID 15757436 (Review)
  • C. D. Carretero-Margolis und D. P. Fivenson: A complete and durable response to denileukin diftitox in a patient with mycosis fungoides. In: J Am Acad Dermatol 48, 2003, S. 275–276. PMID 12582402
  • F. Foss: Clinical experience with denileukin diftitox (ONTAK). In: Semin Oncol 33, 2006, S. S11–16. PMID 16516670 (Review)
  • F. M. Foss: DAB(389)IL-2 (ONTAK): a novel fusion toxin therapy for lymphoma. In: Clin Lymphoma 1, 2000, S. 110–116. PMID 11707818 (Review)
  • B. Y. Wong u. a.: Denileukin diftitox as novel targeted therapy for lymphoid malignancies. In: Cancer Invest 25, 2007, S. 495–501. PMID 17882663
  • M. Duvic und R. Talpur: Optimizing denileukin diftitox (Ontak) therapy. In: Future Oncol 4, 2008, S. 457–469. PMID 18684057 (Review)
  • D. P. Figgitt u. a.: Denileukin diftitox. In: Am J Clin Dermatol 1, 2000, S. 67–72. PMID 11702307
  • M. T. Litzinger u. a.: IL-2 immunotoxin denileukin diftitox reduces regulatory T cells and enhances vaccine-mediated T-cell immunity. In: Blood 110, 2007, S. 3192–3201. PMID 17616639

Einzelnachweise

  1. 1,0 1,1 F. Turturro: Denileukin diftitox: a biotherapeutic paradigm shift in the treatment of lymphoid-derived disorders. In: Expert Rev Anticancer Ther 7, 2007, S. 11–17. PMID 17187516 doi:10.1586/14737140.7.1.11 (Review)
  2. C. Huber (Herausgeber) u. a.: Krebsimmuntherapien. Deutscher Ärzteverlag, 2007, ISBN 3-769-11212-1 S. 129
  3. National Cancer Institute: denileukin diftitox. eingesehen am 10. Juli 2009
  4. rxlist.com: ONTAK® (denileukin diftitox). eingesehen am 10. Juli 2009
  5. M. Park u. a.: Vision loss following denileukin diftitox treatment: a case report of possible posterior ischemic optic neuropathy. In: Leuk Lymphoma 48, 2007, S. 808–811. PMID 17454642

Die News der letzten Tage

17.11.2022
Biochemie | Immunologie | Zytologie
Neue Einblicke in die Funktion von Mitochondrien
Mitochondrien sind vor allem als die Kraftwerke der Zellen bekannt, diese Zellorganellen sind aber nicht nur für die Energiebereitstellung von Bedeutung.
17.11.2022
Meeresbiologie | Taxonomie
Dornenkronenseesterne aus dem Roten Meer sind endemisch!
Neben dem Klimawandel stellen korallenfressende Dornenkronenseesterne (Acanthaster spp.
17.11.2022
Klimawandel | Meeresbiologie
Eisbedeckung im Südpolarmeer: Auswirkungen auf Meiofauna und Makrofauna
Wissenschaftlerinnen haben erstmals untersucht, wie sich Gemeinschaften von Meiofauna und Makrofauna unter verschiedenen Umweltbedingungen im Südpolarmeer zusammensetzen.
16.11.2022
Biochemie | Physiologie
Pflanzen zwischen Licht und Schatten
In der Forschung werden Pflanzen häufig unter konstantem Licht angezogen, was nicht den natürlichen Bedingungen in der Natur entspricht.
15.11.2022
Anthropologie | Ethologie | Paläontologie
Guten Appetit! Homo hat bereits vor 780.000 Jahren Fisch gekocht
Fischzähne der archäologischen Fundstelle Gesher Benot Ya’aqov in Israel liefern den frühesten Hinweis auf das Garen von Nahrungsmitteln durch unsere Vorfahren.
15.11.2022
Biodiversität | Bioinformatik | Botanik
Eine Weltkarte der Pflanzenvielfalt
Warum gibt es an manchen Orten mehr Pflanzenarten als an anderen?
15.11.2022
Biodiversität | Land-, Forst-, Fisch- und Viehwirtschaft | Ökologie
Biodiversität von Wiesen- und Weideflächen: Ein Gewinn für Natur, Landwirtschaft und Tourismus
Ein internationales Team hat in einer langangelegten Studie nachgewiesen, wie wichtig die Biodiversität von Wiesenflächen für ein breites Spektrum von Ökosystemleistungen und unterschiedliche Interessengruppen ist.
15.11.2022
Biochemie | Land-, Forst-, Fisch- und Viehwirtschaft | Zytologie
Wie funktioniert der Mangantransport in Pflanzen?
Das Protein BICAT3 ist einer der wichtigsten Mangan-Verteiler in Pflanzen - ist es defekt, hat das einen verheerenden Einfluss auf das Wachstum der Pflanzen.
14.11.2022
Ökologie | Säugetierkunde
Kollisionsrisiko für Fledermäuse bei großen Windkraftanlagen
Um Fledermäuse vor der Kollision mit Windenergieanlagen zu schützen, werden in Genehmigungsverfahren akustische Erhebungen durchgeführt.
09.11.2022
Physiologie | Vogelkunde
Kohlmeisen: Hormonschwankungen als Überlebensvorteil?
Bei freilebenden Kohlmeisen gibt es zwischen Individuen große Unterschiede in der Menge an Stresshormonen im Blut.